Cusabio Active Proteins
Recombinant Human Fibroblast growth factor 8 (FGF8), partial (Active) | CSB-AP004031HU
- SKU:
- CSB-AP004031HU
- Availability:
- 5 to 10 Working Days
Description
Recombinant Human Fibroblast growth factor 8 (FGF8) ,partial (Active) | CSB-AP004031HU | Cusabio
Protein Description: Partial of Isoform 3
Alternative Name (s) : Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B
Gene Names: FGF8
Research Areas: Cancer
Species: Homo sapiens (Human)
Source: E.coli
Tag Info: Tag-Free
Expression Region: 23-215aa
Sequence Info: QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 100 ng/ml.
MW: 22.5 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Relevance: Fibroblast growth factor 8 (FGFÂ8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-Âdependent growth of mouse mammary carcinoma cells. Mouse FGFÂ8b shares 100% aa identity with human FGFÂ8b. FGFÂ8 is widely expressed during embryogenesis, and mediates epithelialÂ-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55075-3
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A