Recombinant Human Fibroblast growth factor 8 (FGF8), partial (Active) | CSB-AP004041HU

(No reviews yet) Write a Review
SKU:
CSB-AP004041HU
Availability:
5 to 10 Working Days
  • Recombinant Human Fibroblast growth factor 8 (FGF8) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€232.00 - €496.00

Description

Recombinant Human Fibroblast growth factor 8 (FGF8) ,partial (Active) | CSB-AP004041HU | Cusabio

Protein Description: Partial of Isoform 4

Alternative Name (s) : Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B

Gene Names: FGF8

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-244aa

Sequence Info: QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 0.5 ug/ml.

MW: 27.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Fibroblast growth factor 8 (FGF­8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-­dependent growth of mouse mammary carcinoma cells. Mouse FGF­8b shares 100% aa identity with human FGF­8b. FGF­8 is widely expressed during embryogenesis, and mediates epithelial­-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55075-4

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose