Recombinant Human Fibroblast growth factor 10 (FGF10), partial | CSB-EP008616HU(F1)

(No reviews yet) Write a Review
SKU:
CSB-EP008616HU(F1)
Availability:
13 - 23 Working Days
  • Recombinant Human Fibroblast growth factor 10 (FGF10), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Fibroblast growth factor 10 (FGF10), partial | CSB-EP008616HU(F1) | Cusabio

Alternative Name(s): Keratinocyte growth factor 2

Gene Names: FGF10

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: CQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 37-208aa

Sequence Info: Partial

MW: 35.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Reference: "Structural basis by which alternative splicing confers specificity in fibroblast growth factor receptors."Yeh B.K., Igarashi M., Eliseenkova A.V., Plotnikov A.N., Sher I., Ron D., Aaronson S.A., Mohammadi M.Proc. Natl. Acad. Sci. U.S.A. 100:2266-2271(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Involvement in disease: Aplasia of lacrimal and salivary glands (ALSG); Lacrimo-auriculo-dento-digital syndrome (LADDS)

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15520

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose