Recombinant Human Fibroblast growth factor 10 (FGF10), partial | CSB-EP008616HU(F2)

Recombinant Human Fibroblast growth factor 10 (FGF10), partial | CSB-EP008616HU(F2) | Cusabio

Alternative Name(s): Keratinocyte growth factor 2

Gene Names: FGF10

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 41-208aa

Sequence Info: Partial

MW: 35 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Reference: "LADD syndrome is caused by FGF10 mutations."Milunsky J.M., Zhao G., Maher T.A., Colby R., Everman D.B.Clin. Genet. 69:349-354(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Involvement in disease: Aplasia of lacrimal and salivary glands (ALSG); Lacrimo-auriculo-dento-digital syndrome (LADDS)

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15520

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM