Recombinant Human Endothelin-1 receptor (EDNRA) , partial | CSB-YP007403HU1

(No reviews yet) Write a Review
SKU:
CSB-YP007403HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Endothelin-1 receptor (EDNRA) , partial
  • The reducing (R) protein migrates as 55 kDa in SDS-PAGE may be due to glycosylation.
$314.40 - $1,131.60

Description

Recombinant Human Endothelin-1 receptor (EDNRA) , partial | CSB-YP007403HU1 | Cusabio

Alternative Name(s): Endothelin A receptor ;ET-A ;ETA-R ;hET-AR

Gene Names: EDNRA

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-80aa

Sequence Info: Partial

MW: 8.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Reference: Cloning and characterization of cDNA encoding human A-type endothelin receptor.Adachi M., Yang Y.Y., Furuichi Y., Miyamoto C.Biochem. Biophys. Res. Commun. 180:1265-1272(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is

Involvement in disease: Mandibulofacial dysostosis with alopecia (MFDA)

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily

Tissue Specificity: Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25101

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose