Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial | CSB-EP850258HU

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial | CSB-EP850258HU | Cusabio

Alternative Name(s): 2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein ; LP4791 protein ; W117m

Gene Names: ESAM

Research Areas: Cell Adhesion

Organism: Homo sapiens (Human)

AA Sequence: QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-248aa

Sequence Info: Extracellular Domain

MW: 39.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Can mediate aggregation most likely through a homophilic molecular interaction.

Reference: Cloning of an immunoglobulin family adhesion molecule selectively expressed by endothelial cells.Hirata K., Ishida T., Penta K., Rezaee M., Yang E., Wohlgemuth J., Quertermous T.J. Biol. Chem. 276:16223-16231(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Can mediate aggregation most likely through a homophilic molecular interaction.

Involvement in disease:

Subcellular Location: Cell junction, adherens junction, Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Highly expressed in endothelial cells.

Paythway: Leukocytetransendothelialmigration

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96AP7

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM