null

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial | CSB-EP007717HU

(No reviews yet) Write a Review
SKU:
CSB-EP007717HU
Availability:
3 - 7 Working Days
  • Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial | CSB-EP007717HU | Cusabio

Alternative Name(s): Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326

Gene Names: EPCAM

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-265aa

Sequence Info: Partial

MW: 40.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Reference: "Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA."Strnad J., Hamilton A.E., Beavers L.S., Gamboa G.C., Apelgren L.D., Taber L.D., Sportsman J.R., Bumol T.F., Sharp J.D., Gadski R.A.Cancer Res. 49:314-317(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Involvement in disease: Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)

Subcellular Location: Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction

Protein Families: EPCAM family

Tissue Specificity: Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16422

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose