Recombinant Human Elongin-C (ELOC) | CSB-EP023281HU

(No reviews yet) Write a Review
SKU:
CSB-EP023281HU
Availability:
13 - 23 Working Days
  • Recombinant Human Elongin-C (ELOC)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Elongin-C (ELOC) | CSB-EP023281HU | Cusabio

Alternative Name(s): Elongin 15KDA subunitElongin-C ;EloCRNA polymerase II transcription factor SIII subunit CSIII p15

Gene Names: ELOC

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-112aa

Sequence Info: Full Length

MW: 39.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past tplate-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).

Reference: Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.Bullock A.N., Rodriguez M.C., Debreczeni J.E., Songyang Z., Knapp S.Structure 15:1493-1504(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: SKP1 family

Tissue Specificity: Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.

Paythway: HIF-1signalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q15369

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose