Cusabio Human Recombinants
Recombinant Human Elongin-C (ELOC) | CSB-EP023281HU
- SKU:
- CSB-EP023281HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Elongin-C (ELOC) | CSB-EP023281HU | Cusabio
Alternative Name(s): Elongin 15KDA subunitElongin-C ;EloCRNA polymerase II transcription factor SIII subunit CSIII p15
Gene Names: ELOC
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-112aa
Sequence Info: Full Length
MW: 39.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past tplate-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
Reference: Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.Bullock A.N., Rodriguez M.C., Debreczeni J.E., Songyang Z., Knapp S.Structure 15:1493-1504(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: SKP1 family
Tissue Specificity: Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
Paythway: HIF-1signalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q15369
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM