Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) | CSB-CF323723HWV

(No reviews yet) Write a Review
SKU:
CSB-CF323723HWV
Availability:
18 - 23 Working Days
  • Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£515.20 - £721.60

Description

Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) | CSB-CF323723HWV | Cusabio

Alternative Name(s): UL131Uncharacterized protein UL131

Gene Names: UL131

Research Areas: Others

Organism: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

AA Sequence: MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-76aa

Sequence Info: Full Length

MW: 24.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Analysis of the protein-coding content of the sequence of human cytomegalovirus strain AD169."Chee M.S., Bankier A.T., Beck S., Bohni R., Brown C.M., Cerny R., Horsnell T., Hutchison C.A. III, Kouzarides T., Martignetti J.A., Preddie E., Satchwell S.C., Tomlinson P., Weston K.M., Barrell B.G.Curr. Top. Microbiol. Immunol. 154:125-169(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16773

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose