Recombinant Human cytomegalovirus Uncharacterized protein UL128 (UL128) | CSB-YP321481HWVe1

(No reviews yet) Write a Review
SKU:
CSB-YP321481HWVe1
Availability:
25 - 35 Working Days
  • Recombinant Human cytomegalovirus Uncharacterized protein UL128 (UL128)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€491.00 - €1,453.00

Description

Recombinant Human cytomegalovirus Uncharacterized protein UL128 (UL128) | CSB-YP321481HWVe1 | Cusabio

Alternative Name(s): UL128Uncharacterized protein UL128

Gene Names: UL128

Research Areas: Microbiology

Organism: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

AA Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Source: Yeast

Tag Info: Tag-Free

Expression Region: 1-171aa

Sequence Info: Full Length

MW: 19.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The human cytomegalovirus genome revisited: comparison with the chimpanzee cytomegalovirus genome."Davison A.J., Dolan A., Akter P., Addison C., Dargan D.J., Alcendor D.J., McGeoch D.J., Hayward G.S.J. Gen. Virol. 84:17-28(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16837

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose