null

Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) | CSB-YP2069HIZ

(No reviews yet) Write a Review
SKU:
CSB-YP2069HIZ
Availability:
3 - 7 Working Days
  • Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00
Frequently bought together:

Description

Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) | CSB-YP2069HIZ | Cusabio

Alternative Name(s): /

Gene Names: egfp

Research Areas: Microbiology

Organism: Human cytomegalovirus (HHV-5) (Human herpesvirus 5)

AA Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-239aa

Sequence Info: Full Length

MW: 30.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Bacterial artificial chromosome clones of viruses comprising the towne cytomegalovirus vaccine."Cui X., Adler S.P., Davison A.J., Smith L., Habib el.-S.E., McVoy M.A.J. Biomed. Biotechnol. 2012:428498-428498(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: C5MKY7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose