Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) | CSB-RP004144h

(No reviews yet) Write a Review
SKU:
CSB-RP004144h
Availability:
13 - 23 Working Days
  • Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) | CSB-RP004144h | Cusabio

Alternative Name(s): Cytochrome c oxidase polypeptide Va

Gene Names: COX5A

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 42-150aa

Sequence Info: Full Length of Mature Protein

MW: 39.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Reference: Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I.BMC Evol. Biol. 8:8-8(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Involvement in disease: Mitochondrial complex IV deficiency is a rare condition caused by mutation in COX5A that lead to pulmonary arterial hypertension (PAH), failure to thrive and lactic acidemia.

Subcellular Location: Mitochondrion inner membrane

Protein Families: Cytochrome c oxidase subunit 5A family

Tissue Specificity:

Paythway: Cardiacmusclecontraction

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20674

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose