Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) | CSB-EP002271HU

(No reviews yet) Write a Review
SKU:
CSB-EP002271HU
Availability:
3 - 7 Working Days
  • Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$319.20 - $1,728.00

Description

Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) | CSB-EP002271HU | Cusabio

Alternative Name(s): Activating transcription factor 3

Gene Names: ATF3

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-181aa

Sequence Info: Full Length

MW: 26.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Reference: "ATF3 and ATF3 delta Zip. Transcriptional repression versus activation by alternatively spliced isoforms." Chen B.P.C., Liang G., Whelan J., Hai T. J. Biol. Chem. 269:15819-15826(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein binds the cAMP response element (CRE) (consensus

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: BZIP family, ATF subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18847

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose