- Home
- Research Recombinants
- Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-CF880648RA
Cusabio Rattus norvegicus Recombinants
Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-CF880648RA
- SKU:
- CSB-CF880648RA
- UPC:
- MPN:
- Availability:
- 18 - 23 Working Days
Description
Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-CF880648RA | Cusabio
Alternative Name(s): Activating transcription factor 4
Gene Names: Atf4
Research Areas: Epigenetics and Nuclear Signaling
Organism: Rattus norvegicus (Rat)
AA Sequence: MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-347aa
Sequence Info: Full Length
MW: 45.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Transcription factor that binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3') and acts both as a regulator of normal metabolic and redox processes, and as a master transcription factor during the integrated stress response (ISR) (By similarity). Binds to asymmetric CRE's as a heterodimer and to palindromic CRE's as a homodimer (By similarity). Core effector of the ISR, which is required for adaptation to various stress, such as endoplasmic reticulum (ER) stress, amino acid starvation, mitochondrial stress or oxidative stress. During the ISR, ATF4 protein is translated in response to eIF-2-alpha/EIF2S1 phosphorylation caused by stress, and acts as a master transcription factor of stress-responsive genes in order to promote cell recovery (By similarity). Protects cells against metabolic consequences of ER oxidation by promoting expression of genes linked to amino acid sufficiency and resistance to oxidative stress (By similarity). Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to amino acid deprivation or endoplasmic reticulum (ER) stress (By similarity). Together with DDIT3/CHOP, mediates ER-mediated cell death by promoting expression of genes involved in cellular amino acid metabolic processes, mRNA translation and the unfolded protein response (UPR) in response to ER stress (By similarity). ATF4 and DDIT3/CHOP activate the transcription of TRIB3 and promote ER stress-induced neuronal cell-death by regulating the expression of BBC3/PUMA. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors. Activates expression of genes required to promote cell recovery in response to mitochondrial stress (By similarity). Independently of the ISR, also required for normal metabolic processes: plays a key role in embryonic lens formation, fetal liver hematopoiesis, bone development and synaptic plasticity (By similarity). Acts as a regulator of osteoblast differentiation in response to phosphorylation by RPS6KA3/RSK2: phosphorylation in osteoblasts enhances transactivation activity and promotes expression of osteoblast-specific genes and post-transcriptionally regulates the synthesis of Type I collagen, the main constituent of the bone matrix (By similarity). Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. Mainly acts as a transcriptional activator in cellular stress adaptation, but it can also act as a transcriptional repressor: acts as a regulator of synaptic plasticity by repressing transcription, thereby inhibiting induction and maintenance of long-term memory (By similarity). Regulates synaptic functions via interaction with DISC1 in neurons, which inhibits ATF4 transcription factor activity by disrupting ATF4 dimerization and DNA-binding (By similarity)
Reference: "Activation transcription factor-4 induced by fibroblast growth factor-2 regulates vascular endothelial growth factor-A transcription in vascular smooth muscle cells and mediates intimal thickening in rat arteries following balloon injury." Malabanan K.P., Kanellakis P., Bobik A., Khachigian L.M. Circ. Res. 103:378-387(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9ES19
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Human Cyclic AMP-dependent transcription factor ATF-2 (ATF2) | CSB-EP002270HU
Cusabio Human Recombinants

Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) | CSB-EP002271HU
Cusabio Human Recombinants

Recombinant Human Cyclic AMP-dependent transcription factor ATF-7 (ATF7) | CSB-EP002279HU
Cusabio Human Recombinants

Recombinant Rat Runt-related transcription factor 1 (Runx1) | CSB-EP020592RA
Cusabio Rattus norvegicus Recombinants

Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-EP880648RA
Cusabio Rattus norvegicus Recombinants
Customers Also Viewed

Recombinant Human Cyclic AMP-dependent transcription factor ATF-7 (ATF7) | CSB-EP002279HU
Cusabio Human Recombinants

Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-EP880648RA
Cusabio Rattus norvegicus Recombinants

Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) | CSB-EP002271HU
Cusabio Human Recombinants

Recombinant Human Cyclic AMP-dependent transcription factor ATF-2 (ATF2) | CSB-EP002270HU
Cusabio Human Recombinants

Recombinant Rat Runt-related transcription factor 1 (Runx1) | CSB-EP020592RA
Cusabio Rattus norvegicus Recombinants

VSV-G-Tag Monoclonal Antibody | CSB-MA000161
Cusabio Tag & Control

Rabbit anti-Sheep IgG Antibody | CSB-PA00110E1Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;FITC conjugated | CSB-PA00410G0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;Biotin conjugated | CSB-PA00410H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody | CSB-PA00410E0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;Biotin conjugated | CSB-PA00570H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;HRP conjugated | CSB-PA00570F0Rb
Cusabio Secondary Antibodies

Goat Anti-Rabbit IgG(H+L) Antibody; HRP conjugated | CSB-PA564648
Cusabio Secondary Antibodies

MET Antibody | CSB-RA634199A0HU
Cusabio Recombinant Antibodies

HSF1 Antibody | CSB-RA279005A0HU
Cusabio Recombinant Antibodies

ABAT Antibody | CSB-RA242969A0HU
Cusabio Recombinant Antibodies

AKR1C3 Antibody | CSB-RA825204A0HU
Cusabio Recombinant Antibodies

RHOA Antibody | CSB-RA546523A0HU
Cusabio Recombinant Antibodies

FGFR2 Antibody | CSB-RA154582A0HU
Cusabio Recombinant Antibodies

ESR1 Antibody | CSB-RA942338A0HU
Cusabio Recombinant Antibodies

RPTOR Antibody | CSB-RA581950A0HU
Cusabio Recombinant Antibodies

CEACAM1 Antibody | CSB-RA147192A0HU
Cusabio Recombinant Antibodies

GSK3B Antibody | CSB-RA216259A0HU
Cusabio Recombinant Antibodies

SIRT1 Antibody | CSB-RA556800A0HU
Cusabio Recombinant Antibodies

NONO Antibody | CSB-RA273277A0HU
Cusabio Recombinant Antibodies

RPS6KB1 Antibody | CSB-RA299200A0HU
Cusabio Recombinant Antibodies

MAPK14 Antibody | CSB-RA582884A0HU
Cusabio Recombinant Antibodies

CDK2 Antibody | CSB-RA961467A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA241798A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA286668A0HU
Cusabio Recombinant Antibodies

CD47 Antibody | CSB-RA802124A0HU
Cusabio Recombinant Antibodies

BCHE Antibody | CSB-RA252650A0HU
Cusabio Recombinant Antibodies

CD80 Antibody | CSB-RA246383A0HU
Cusabio Recombinant Antibodies

ACLY Antibody | CSB-RA712206A0HU
Cusabio Recombinant Antibodies

ATF4 Antibody | CSB-RA002272A0HU
Cusabio Recombinant Antibodies

ARNT Antibody | CSB-RA002121A0HU
Cusabio Recombinant Antibodies

Phospho-SNCA (S129) Antibody | CSB-RA021912A129phHU
Cusabio Recombinant Antibodies

Acetyl-Histone H2B type 1-B(K20)Antibody | CSB-RA010402A20acHU
Cusabio Recombinant Antibodies

Acetyl-Histone H3.1(K56)Antibody | CSB-RA010418A56acHU
Cusabio Recombinant Antibodies

Histone H3.3 Antibody | CSB-RA010109A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H1.4 (T17) Antibody | CSB-RA010380A17phHU
Cusabio Recombinant Antibodies

CD45 Antibody | CSB-RA019049A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H3.3 (T3) Antibody | CSB-RA010109A03phHU
Cusabio Recombinant Antibodies

VPS26A Antibody, Biotin conjugated | CSB-PA025898LD01HU
Cusabio Polyclonal Antibodies

SUMF2 Antibody, Biotin conjugated | CSB-PA839844LD01HU
Cusabio Polyclonal Antibodies

SRC Antibody, FITC conjugated | CSB-PA022650LC11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB11HU
Cusabio Polyclonal Antibodies

SRC Antibody | CSB-PA022650LA11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB01HU
Cusabio Polyclonal Antibodies

PIBF1 Antibody, HRP conjugated | CSB-PA845171LB01HU
Cusabio Polyclonal Antibodies