Recombinant Human COMM domain-containing protein 4 (COMMD4), partial | CSB-RP049644h

(No reviews yet) Write a Review
SKU:
CSB-RP049644h
Availability:
13 - 23 Working Days
  • Recombinant Human COMM domain-containing protein 4 (COMMD4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial | CSB-RP049644h | Cusabio

Alternative Name(s): COMD4_HUMAN; COMM domain containing 4; COMM domain-containing protein 4; COMMD4

Gene Names: COMMD4

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-195aa

Sequence Info: Partial

MW: 48.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.

Reference: COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families:

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H0A8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose