Cusabio Human Recombinants
Recombinant Human COMM domain-containing protein 4 (COMMD4), partial | CSB-RP049644h
- SKU:
- CSB-RP049644h
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human COMM domain-containing protein 4 (COMMD4), partial | CSB-RP049644h | Cusabio
Alternative Name(s): COMD4_HUMAN; COMM domain containing 4; COMM domain-containing protein 4; COMMD4
Gene Names: COMMD4
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-195aa
Sequence Info: Partial
MW: 48.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.
Reference: COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes
Involvement in disease:
Subcellular Location: Cytoplasm, Nucleus
Protein Families:
Tissue Specificity: Ubiquitous.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9H0A8
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM