Recombinant Human CMP-N-acetylneuraminate-beta-1, 4-galactoside alpha-2, 3-sialyltransferase (ST3GAL3), partial | CSB-EP606136HU

Recombinant Human CMP-N-acetylneuraminate-beta-1, 4-galactoside alpha-2, 3-sialyltransferase (ST3GAL3), partial | CSB-EP606136HU | Cusabio

Alternative Name(s): Beta-galactoside alpha-2,3-sialyltransferase 3 ;Alpha 2,3-ST 3Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferaseN-acetyllactosaminide alpha-2,3-sialyltransferase;ST3Gal III ;ST3GalIIIST3NSialyltransferase 6

Gene Names: ST3GAL3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 29-375aa

Sequence Info: Partial

MW: 54.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc .

Reference: West syndrome caused by ST3Gal-III deficiency.Edvardson S., Baumann A.M., Muehlenhoff M., Stephan O., Kuss A.W., Shaag A., He L., Zenvirt S., Tanzi R., Gerardy-Schahn R., Elpeleg O.Epilepsia 54:E24-E27(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc.

Involvement in disease: Mental retardation, autosomal recessive 12 (MRT12); Epileptic encephalopathy, early infantile, 15 (EIEE15)

Subcellular Location: Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted

Protein Families: Glycosyltransferase 29 family

Tissue Specificity: Highly expressed in adult skeletal muscle and in all fetal tissues examined and to a much lesser extent in placenta, lung and liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q11203

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM