Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2, 8-sialyltransferase (ST8SIA4) | CSB-EP821630HU

Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2, 8-sialyltransferase (ST8SIA4) | CSB-EP821630HU | Cusabio

Alternative Name(s): Alpha-2,8-sialyltransferase 8DPolysialyltransferase-1Sialyltransferase 8D ;SIAT8-DSialyltransferase St8Sia IV ;ST8SiaIV

Gene Names: ST8SIA4

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-168aa

Sequence Info: Full Length of Isoform 2

MW: 32.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Reference: Expression cloning of a human polysialyltransferase that forms the polysialylated neural cell adhesion molecule present in embryonic brain.Nakayama J., Fukuda M.N., Fredette B., Ranscht B., Fukuda M.Proc. Natl. Acad. Sci. U.S.A. 92:7031-7035(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.

Involvement in disease:

Subcellular Location: Golgi apparatus membrane, Single-pass type II membrane protein

Protein Families: Glycosyltransferase 29 family

Tissue Specificity: Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q92187

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM