null

Recombinant Human Centrin-3 (CETN3) | CSB-EP005266HU

(No reviews yet) Write a Review
SKU:
CSB-EP005266HU
Availability:
13 - 23 Working Days
  • Recombinant Human Centrin-3 (CETN3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00
Frequently bought together:

Description

Recombinant Human Centrin-3 (CETN3) | CSB-EP005266HU | Cusabio

Alternative Name(s): CDC31 homolog; CEN 3; CEN3; Centrin EF hand protein 3; Centrin-3; Centrin3; CETN 3; Cetn3; CETN3_HUMAN; EF hand superfamily member; MGC12502; MGC138245

Gene Names: CETN3

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-167aa

Sequence Info: Full Length

MW: 46.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery

Reference: "Identification of a new mammalian centrin gene, more closely related to Saccharomyces cerevisiae CDC31 gene." Middendorp S., Paoletti A., Schiebel E., Bornens M. Proc. Natl. Acad. Sci. U.S.A. 94:9141-9146(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, nucleolus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole

Protein Families: Centrin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15182

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose