Recombinant Human Carbonic anhydrase 5B, mitochondrial (CA5B) (Active) | CSB-AP005641HU

Recombinant Human Carbonic anhydrase 5B, mitochondrial (CA5B) (Active) | CSB-AP005641HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B

Gene Names: CA5B

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 34-317aa

Sequence Info: CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

Biological Activity: The esterase activity is determined to be greater than 1000 pmol/min/ug

MW: 33.77 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Carbonic Anhydrase 5B (CA5B) is a member of alpha-carbonic anhydrase family (CAs) that catalyze the reversible hydration of carbon dioxide. CAs is associated with many biological processes, including calcification, respiration, bone resorption, acid-base balance and the formation of aqueous humor. CA5B is highly expressed in heart, pancreas, kidney, placenta, lung, and skeletal muscle, but it is restricted to the liver. CA5B is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA-VA. CA5B is inhibited by coumarins, sulfonamide derivatives such as acetazolamide (AZA) , saccharin, and Foscarnet.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Reversible hydration of carbon dioxide.

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: Alpha-carbonic anhydrase family

Tissue Specificity: Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver.

Paythway:

Form: Liquid

Buffer: 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0

Reconstitution:

Uniprot ID: Q9Y2D0

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM