Recombinant Human Carbonic anhydrase 5A, mitochondrial (CA5A) | CSB-MP004373HU

(No reviews yet) Write a Review
SKU:
CSB-MP004373HU
Availability:
18 - 28 Working Days
  • Recombinant Human Carbonic anhydrase 5A, mitochondrial (CA5A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £2,962.40

Description

Recombinant Human Carbonic anhydrase 5A, mitochondrial (CA5A) | CSB-MP004373HU | Cusabio

Alternative Name(s): Carbonate dehydratase VA Carbonic anhydrase VA

Gene Names: CA5A

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: CAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 39-305aa

Sequence Info: Full Length of Mature Protein

MW: 33.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Reversible hydration of carbon dioxide. Low activity.

Reference: "Genomic organization of the human gene (CA5) and pseudogene for mitochondrial carbonic anhydrase V and their localization to chromosomes 16q and 16p." Nagao Y., Batanian J.R., Clemente M.F., Sly W.S. Genomics 28:477-484(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35218

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose