Recombinant Human Carbonic anhydrase 13 (CA13) (Active) | CSB-AP005401HU

Recombinant Human Carbonic anhydrase 13 (CA13) (Active) | CSB-AP005401HU | Cusabio

Protein Description: Full Length

Alternative Name (s) : Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA-XIII; CA13

Gene Names: CA13

Research Areas: Cell Biology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-262aa

Sequence Info: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

Biological Activity: The esterase activity is determined to be greater than 1000 pmol/min/ug

MW: 30.51 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Carbonic Anhydrase 13 (CA13) belongs to the carbonic anhydrase family which can catalyzes the reversible hydration recation of carbon dioxide. Carbonic anhydrases participate in many biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA13 is a cytosolic enzyme and is widely expressed in human, such as thymus, small intestine, spleen, prostate, ovary, colon and testis, indicating that it may play a key role in several organs. CA13 is inhibited by acetazolamide.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Reversible hydration of carbon dioxide.

Involvement in disease:

Subcellular Location:

Protein Families: Alpha-carbonic anhydrase family

Tissue Specificity: Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.

Paythway:

Form: Liquid

Buffer: 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5

Reconstitution:

Uniprot ID: Q8N1Q1

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM