Recombinant Human Calmodulin-like protein 5 (CALML5) | CSB-EP973713HU

Recombinant Human Calmodulin-like protein 5 (CALML5) | CSB-EP973713HU | Cusabio

Alternative Name(s): Calmodulin-like skin protein

Gene Names: CALML5

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-146aa

Sequence Info: Full Length of Mature Protein

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds calcium. May be involved in terminal differentiation of keratinocytes.

Reference: Identification and cloning of a new calmodulin-like protein from human epidermis.Mehul B., Bernard D., Simonetti L., Bernard M.A., Schmidt R.J. Biol. Chem. 275:12841-12847(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds calcium. May be involved in terminal differentiation of keratinocytes.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.

Paythway: Calciumsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NZT1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM