Cusabio Human Recombinants
Recombinant Human Calmodulin-like protein 3 (CALML3) | CSB-EP004453HU
- SKU:
- CSB-EP004453HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Calmodulin-like protein 3 (CALML3) | CSB-EP004453HU | Cusabio
Alternative Name(s): CaM-like protein
Gene Names: CALML3
Research Areas: Tags & Cell Markers
Organism: Homo sapiens (Human)
AA Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-149aa
Sequence Info: Full Length
MW: 43.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Reference: "Down-regulation of a calmodulin-related gene during transformation of human mammary epithelial cells." Yaswen P., Smoll A., Peehl D.M., Trask D.K., Sager R., Stampfer M.R. Proc. Natl. Acad. Sci. U.S.A. 87:7360-7364(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Involvement in disease:
Subcellular Location:
Protein Families: Calmodulin family
Tissue Specificity: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
Paythway: Calciumsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P27482
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM