Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) | CSB-EP004469HU

Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) | CSB-EP004469HU | Cusabio

Alternative Name(s): CaMKII inhibitory protein alpha (CaMKIIN-alpha)

Gene Names: CAMK2N1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

Source: E.coli

Tag Info: N-terminal 6xHis-Trx-tagged

Expression Region: 1-78aa

Sequence Info: Full Length

MW: 25.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Potent and specific inhibitor of CaM-kinase II.

Reference: "Human gingiva transcriptome during wound healing." Wang Y., Tatakis D.N. J. Clin. Periodontol. 44:394-402(2017)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Potent and specific inhibitor of CaM-kinase II (CAMK2).

Involvement in disease:

Subcellular Location: Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density

Protein Families: CAMK2N family

Tissue Specificity: Widely expressed. Nor detected in skeletal muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7Z7J9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM