Recombinant Mouse Calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1) | CSB-EP004469MO

Recombinant Mouse Calcium/calmodulin-dependent protein kinase II inhibitor 1 (Camk2n1) | CSB-EP004469MO | Cusabio

Alternative Name(s): calcium/calmodulin-dependent protein kinase II inhibitor alpha ;mCaMKIINalpha

Gene Names: Camk2n1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-78aa

Sequence Info: Full Length

MW: 24.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Potent and specific inhibitor of CaM-kinase II (CAMK2).

Reference: Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Potent and specific inhibitor of CaM-kinase II (CAMK2).

Involvement in disease:

Subcellular Location: Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density

Protein Families: CAMK2N family

Tissue Specificity: Brain specific (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6QWF9

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A