Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active) | CSB-AP003791HU

(No reviews yet) Write a Review
SKU:
CSB-AP003791HU
Availability:
5 to 10 Working Days
  • Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£185.60 - £396.80

Description

Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active) | CSB-AP003791HU | Cusabio

Protein Description: Full Length

Alternative Name (s) : Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

Gene Names: BDNF

Research Areas: Neuroscience

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 19-247aa (R125A,R127A,R128A)

Sequence Info: APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMAVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Biological Activity: The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.

MW: 25.9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: The precursor form of Brain-Derived Neurotrophic Factor (pro-BDNF) interacts preferentially with the pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin and induces neuronal apoptosis, whereas mature BDNF selectively binds with high affinity to the TrkB kinase receptor and promotes the survival, growth and differentiation of neurons. As proneurotrophins and mature neurotrophins elicit opposite biological effects, Pro-BDNF cleavage in the neuronal system is regulated in a specific and cell-context dependent manner. Pro-BDNF plays important role in negative regulation of neurotrophic actions in the brain.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP) , long-term depression (LTD) , certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Involvement in disease: Bulimia nervosa 2 (BULN2) ; Congenital central hypoventilation syndrome (CCHS)

Subcellular Location: Secreted

Protein Families: NGF-beta family

Tissue Specificity: Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Paythway: cAMPsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23560

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose