Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active) | CSB-AP003781HU

Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active) | CSB-AP003781HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

Gene Names: BDNF

Research Areas: Neuroscience

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 129-247aa

Sequence Info: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Biological Activity: The ED50 as determined by its ability to bind Human TrkB in functional ELISA is less than 5 ug/ml.

MW: 13 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75) . BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP) , long-term depression (LTD) , certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Involvement in disease: Bulimia nervosa 2 (BULN2) ; Congenital central hypoventilation syndrome (CCHS)

Subcellular Location: Secreted

Protein Families: NGF-beta family

Tissue Specificity: Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.

Paythway: cAMPsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23560

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM