Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-MP019677HU

(No reviews yet) Write a Review
SKU:
CSB-MP019677HU
Availability:
18 - 28 Working Days
  • Recombinant Human Blood group Rh (D) polypeptide (RHD), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$634.80 - $4,443.60

Description

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-MP019677HU | Cusabio

Alternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D

Gene Names: RHD

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Source: Mammalian cell

Tag Info: N-terminal GST-tagged

Expression Region: 388-417aa

Sequence Info: Partial

MW: 29.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Reference: "Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: Ammonium transporter (TC 2.A.49) family, Rh subfamily

Tissue Specificity: Restricted to tissues or cell lines expressing erythroid characters.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q02161

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose