Cusabio Human Recombinants
Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-EP019677HU
- SKU:
- CSB-EP019677HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-EP019677HU | Cusabio
Alternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D
Gene Names: RHD
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Source: E.coli
Tag Info: N-terminal 6xHis-GST-tagged
Expression Region: 388-417aa
Sequence Info: Partial
MW: 33.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Reference: "Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: Ammonium transporter (TC 2.A.49) family, Rh subfamily
Tissue Specificity: Restricted to tissues or cell lines expressing erythroid characters.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q02161
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM
 
             
             
                         
                         
             
             
             
            