Recombinant Human Biglycan (BGN) | CSB-EP002683HU

Recombinant Human Biglycan (BGN) | CSB-EP002683HU | Cusabio

Alternative Name(s): Bone/cartilage proteoglycan I PG-S1

Gene Names: BGN

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 38-368aa

Sequence Info: Full Length of Mature Protein

MW: 57.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in collagen fiber assembly.

Reference: "Deduced protein sequence of bone small proteoglycan I (biglycan) shows homology with proteoglycan II (decorin) and several nonconnective tissue proteins in a variety of species." Fisher L.W., Termine J.D., Young M.F. J. Biol. Chem. 264:4571-4576(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in collagen fiber assembly.

Involvement in disease: Meester-Loeys syndrome (MRLS); Spondyloepimetaphyseal dysplasia, X-linked (SEMDX)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily

Tissue Specificity: Found in several connective tissues, especially in articular cartilages.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21810

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM