Recombinant Mouse Biglycan (Bgn) | CSB-EP002683MO

(No reviews yet) Write a Review
SKU:
CSB-EP002683MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Biglycan (Bgn)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP002683MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.
$357.60 - $2,042.40

Description

Recombinant Mouse Biglycan (Bgn) | CSB-EP002683MO | Cusabio

Alternative Name(s): Bone/cartilage proteoglycan I (PG-S1)

Gene Names: Bgn

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 38-369aa

Sequence Info: Full Length of Mature Protein

MW: 43.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be involved in collagen fiber assembly.

Reference: "Abnormal collagen fibrils in tendons of biglycan/fibromodulin-deficient mice lead to gait impairment, ectopic ossification, and osteoarthritis." Ameye L., Aria D., Jepsen K., Oldberg A., Xu T., Young M.F. FASEB J. 16:673-680(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28653

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose