Recombinant Human Arginase-1 (ARG1) (Active) | CSB-AP005561HU

Recombinant Human Arginase-1 (ARG1) (Active) | CSB-AP005561HU | Cusabio

Protein Description: Full Length

Alternative Name (s) : Arginase-1; Liver-type arginase;Type I arginase;ARG1

Gene Names: ARG1

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-322aa

Sequence Info: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Biological Activity: Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 6000 pmol/min/µg.

MW: 35.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.

Involvement in disease: Argininemia (ARGIN)

Subcellular Location: Cytoplasm, Cytoplasmic granule

Protein Families: Arginase family

Tissue Specificity: Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957) . Also detected in macrophages mycobacterial granulomas (PubMed:23749634) . Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409) .

Paythway:

Form: Liquid

Buffer: 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, 1 mM DTT, pH 7.4

Reconstitution:

Uniprot ID: P05089

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM