Cusabio Human Recombinants
Recombinant Human Aquaporin-4 (AQP4), partial | CSB-YP001964HU
- SKU:
- CSB-YP001964HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Aquaporin-4 (AQP4), partial | CSB-YP001964HU | Cusabio
Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4
Gene Names: AQP4
Research Areas: Transport
Organism: Homo sapiens (Human)
AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 253-323aa
Sequence Info: Partial
MW: 10 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.
Reference: Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: MIP/aquaporin (TC 1.A.8) family
Tissue Specificity: Brain - muscle >> heart, kidney, lung, and trachea.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55087
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM