Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial | CSB-EP002127HU1

(No reviews yet) Write a Review
SKU:
CSB-EP002127HU1
Availability:
13 - 23 Working Days
  • Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial | CSB-EP002127HU1 | Cusabio

Alternative Name(s): Arp2/3 complex 34KDA subunit ;p34-AR;C

Gene Names: ARPC2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDY

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-250aa

Sequence Info: Partial

MW: 55.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Ses to contact the mother actin filament.

Reference: The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J.J. Cell Biol. 138:375-384(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton, Cell projection, Cell junction, synapse, synaptosome

Protein Families: ARPC2 family

Tissue Specificity:

Paythway: Regulationofactincytoskeleton

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15144

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose