Cusabio Human Recombinants
Recombinant Human Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L) | CSB-EP861078HU
- SKU:
- CSB-EP861078HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Actin-related protein 2/3 complex subunit 5-like protein (ARPC5L) | CSB-EP861078HU | Cusabio
Alternative Name(s): Arp2/3 complex 16KDA subunit
Gene Names: ARPC5
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-154aa
Sequence Info: Full Length of Isoform 2
MW: 43.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Reference: "The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly." Welch M.D., Depace A.H., Verma S., Iwamatsu A., Mitchison T.J. J. Cell Biol. 138:375-384(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
Involvement in disease:
Subcellular Location: Cytoplasm, cytoskeleton, Cell projection
Protein Families: ARPC5 family
Tissue Specificity:
Paythway: Regulationofactincytoskeleton
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O15511
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM