Recombinant Horse Myelin P2 protein (PMP2) | CSB-EP315130HO

Recombinant Horse Myelin P2 protein (PMP2) | CSB-EP315130HO | Cusabio

Alternative Name(s): PMP2; Myelin P2 protein

Gene Names: PMP2

Research Areas: Others

Organism: Equus caballus (Horse)

AA Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-132aa

Sequence Info: Full Length of Mature Protein

MW: 30.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Reference: "Structure of myelin P2 protein from equine spinal cord."Hunter D.J., Macmaster R., Roszak A.W., Riboldi-Tunnicliffe A., Griffiths I.R., Freer A.A.Acta Crystallogr. D 61:1067-1071(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in lipid transport protein in Schwann cells. May bind cholesterol.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity: Detected in spinal cord (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0C6G6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A