Recombinant Hordeum vulgare Oxalate oxidase 1 | CSB-EP332739HWQ

(No reviews yet) Write a Review
SKU:
CSB-EP332739HWQ
Availability:
3 - 7 Working Days
  • Recombinant Hordeum vulgare Oxalate oxidase 1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Hordeum vulgare Oxalate oxidase 1 | CSB-EP332739HWQ | Cusabio

Alternative Name(s): Germin

Gene Names: N/A

Research Areas: Signal Transduction

Organism: Hordeum vulgare (Barley)

AA Sequence: SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-201aa

Sequence Info: Full Length

MW: 28.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.

Reference: "Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities." Woo E.-J., Dunwell J.M., Goodenough P.W., Marvier A.C., Pickersgill R.W. Nat. Struct. Biol. 7:1036-1040(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, apoplast, Secreted, cell wall

Protein Families: Germin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P45850

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose