Cusabio Virus & Bacteria Recombinants
Recombinant Hordeum vulgare Oxalate oxidase 1 | CSB-EP332739HWQ
- SKU:
- CSB-EP332739HWQ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Hordeum vulgare Oxalate oxidase 1 | CSB-EP332739HWQ | Cusabio
Alternative Name(s): Germin
Gene Names: N/A
Research Areas: Signal Transduction
Organism: Hordeum vulgare (Barley)
AA Sequence: SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-201aa
Sequence Info: Full Length
MW: 28.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.
Reference: "Germin is a manganese containing homohexamer with oxalate oxidase and superoxide dismutase activities." Woo E.-J., Dunwell J.M., Goodenough P.W., Marvier A.C., Pickersgill R.W. Nat. Struct. Biol. 7:1036-1040(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.
Involvement in disease:
Subcellular Location: Secreted, extracellular space, apoplast, Secreted, cell wall
Protein Families: Germin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P45850
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A