Recombinant Hevea brasiliensis Pro-hevein (HEV1) | CSB-EP365797HWI

(No reviews yet) Write a Review
SKU:
CSB-EP365797HWI
Availability:
3 - 7 Working Days
  • Recombinant Hevea brasiliensis Pro-hevein (HEV1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £380.00

Description

Recombinant Hevea brasiliensis Pro-hevein (HEV1) | CSB-EP365797HWI | Cusabio

Alternative Name(s): Major hevein

Gene Names: HEV1

Research Areas: Others

Organism: Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

AA Sequence: EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-204aa

Sequence Info: Full Length of Mature Protein

MW: 24.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

Reference: "Wound-induced accumulation of mRNA containing a hevein sequence in laticifers of rubber tree (Hevea brasiliensis)." Broekaert W.F., Lee H.I., Kush A., Chua N.H., Raikhel N. Proc. Natl. Acad. Sci. U.S.A. 87:7633-7637(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Laticifer.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02877

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose