Cusabio Helicobacter pylori Recombinants
Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA) | CSB-EP009053HUV
- SKU:
- CSB-EP009053HUV
- Availability:
- 3 - 7 Working Days
Description
Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA) | CSB-EP009053HUV | Cusabio
Alternative Name(s): pfr
Gene Names: ftnA
Research Areas: Others
Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
AA Sequence: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-167aa
Sequence Info: Full Length
MW: 24.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Iron-storage protein.
Reference: "Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins." Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Iron-storage protein.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Ferritin family, Prokaryotic subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P52093
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A