Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA) | CSB-EP009053HUV

(No reviews yet) Write a Review
SKU:
CSB-EP009053HUV
Availability:
3 - 7 Working Days
  • Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA) | CSB-EP009053HUV | Cusabio

Alternative Name(s): pfr

Gene Names: ftnA

Research Areas: Others

Organism: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

AA Sequence: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-167aa

Sequence Info: Full Length

MW: 24.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Iron-storage protein.

Reference: "Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins." Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Iron-storage protein.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Ferritin family, Prokaryotic subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52093

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose