Recombinant Hafnia alvei Intimin (eaeA) | CSB-EP346794HAQ

(No reviews yet) Write a Review
SKU:
CSB-EP346794HAQ
Availability:
3 - 7 Working Days
  • Recombinant Hafnia alvei Intimin (eaeA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Hafnia alvei Intimin (eaeA) | CSB-EP346794HAQ | Cusabio

Alternative Name(s): Attaching and effacing protein Outer membrane protein

Gene Names: eaeA

Research Areas: Microbiology

Organism: Hafnia alvei

AA Sequence: ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-280aa

Sequence Info: Full Length

MW: 46.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Necessary for the production of attaching and effacing lesions on tissue culture cells.

Reference: "Characterization of the C-terminal domains of intimin-like proteins of enteropathogenic and enterohemorrhagic Escherichia coli, Citrobacter freundii, and Hafnia alvei."Frankel G., Candy D.C.A., Everest P., Dougan G.Infect. Immun. 62:1835-1842(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Necessary for the production of attaching and effacing lesions on tissue culture cells.

Involvement in disease:

Subcellular Location: Cell outer membrane, Single-pass membrane protein

Protein Families: Intimin/invasin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52869

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose