null

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial | CSB-EP514896EOF

(No reviews yet) Write a Review
SKU:
CSB-EP514896EOF
Availability:
13 - 23 Working Days
  • Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Escherichia coli O157:H7 Translocated intimin receptor Tir (tir), partial | CSB-EP514896EOF | Cusabio

Alternative Name(s): Secreted effector protein Tir

Gene Names: tir

Research Areas: Others

Organism: Escherichia coli O157:H7 (strain TW14359 / EHEC)

AA Sequence: QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 252-362aa

Sequence Info: Extracellular Domain

MW: 27.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The Extracellular domain region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion

Reference: "Analysis of the genome of the Escherichia coli O157:H7 2006 spinach-associated outbreak isolate indicates candidate genes that may enhance virulence."Kulasekara B.R., Jacobs M., Zhou Y., Wu Z., Sims E., Saenphimmachak C., Rohmer L., Ritchie J.M., Radey M., McKevitt M., Freeman T.L., Hayden H., Haugen E., Gillett W., Fong C., Chang J., Beskhlebnaya V., Waldor M.K. Miller S.I.Infect. Immun. 77:3713-3721(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The extracellular region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion (By similarity).

Involvement in disease:

Subcellular Location: Secreted, Host cell membrane, Multi-pass membrane protein

Protein Families: Tir receptor family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: C6UYL8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose