- Home
- Research Recombinants
- Recombinant Escherichia coli O157:H7 NADH pyrophosphatase (nudC) | CSB-EP845206EOD
Cusabio Escherichia coli O157:H7 Recombinants
Recombinant Escherichia coli O157:H7 NADH pyrophosphatase (nudC) | CSB-EP845206EOD
- SKU:
- CSB-EP845206EOD
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Escherichia coli O157:H7 NADH pyrophosphatase (nudC) | CSB-EP845206EOD | Cusabio
Alternative Name(s): /
Gene Names: nudC
Research Areas: Cell Biology
Organism: Escherichia coli O157:H7
AA Sequence: MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLIQQQRRYDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-257aa
Sequence Info: Full length
MW: 33.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Catalytic activity H2O + NAD+ = AMP + ?-nicotinamide D-ribonucleotide + 2 H+
Reference: "Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12." Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T. Shinagawa H. DNA Res. 8:11-22(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8X6X7
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-EP017707EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 flagellin (fliC? | CSB-EP2353EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli dITP/XTP pyrophosphatase (rdgB) | CSB-EP345967ENV
Cusabio Escherichia coli Recombinants

Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA) | CSB-EP359761EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-YP017707EOD
Cusabio Escherichia coli O157:H7 Recombinants
Customers Also Viewed

Recombinant Escherichia coli O157:H7 flagellin (fliC? | CSB-EP2353EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-YP017707EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-EP017707EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 Metalloprotease stcE (stcE), partial | CSB-EP530572EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Escherichia coli O157:H7 Outer membrane protein A (ompA), partial | CSB-EP359226EOD
Cusabio Escherichia coli O157:H7 Recombinants

Recombinant Staphylococcus aureus Peptide deformylase (def) | CSB-YP017707FKZ
Cusabio Staphylococcus aureus Recombinants

Recombinant Escherichia coli Flagellin (fliC) | CSB-EP300968ENVe1
Cusabio Escherichia coli Recombinants

Recombinant Escherichia coli Flagellin (fliC) | CSB-EP300968ENV
Cusabio Escherichia coli Recombinants

CXCL8 Antibody, FITC conjugated | CSB-PA011671YC01DO
Cusabio Polyclonal Antibodies

Rat rotavirus (RV) antigen (Ag) ELISA kit | CSB-EQ027718RA
Cusabio Elisa

Human ovalbumin specific IgG, OVA sIgG ELISA Kit | CSB-E10127h
Cusabio Elisa

Human Dickkopf-related protein 4 (DKK4) ELISA kit | CSB-EL006923HU
Cusabio Elisa

Rat periostin/osteoblast specific factor 2 (POSTN) ELISA kit | CSB-EL018381RA
Cusabio Elisa

Human myelin basic protein (MBP) antibody ELISA Kit | CSB-E04787h
Cusabio Elisa

Human anti-saccharomyces cerevisiae antibody (IgA) ELISA Kit | CSB-E15026h
Cusabio Elisa

Rat Thrombopoietin, TPO ELISA kit | CSB-E07378r
Cusabio Elisa

Mouse Protein S100-A9 (S100A9) ELISA kit | CSB-EL020642MO
Cusabio Elisa

Mouse Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548MO
Cusabio Elisa

Human Regenerating islet-derived protein 3-alpha (REG3A) ELISA kit | CSB-EL019548HU
Cusabio Elisa

Rat Prostaglandin-H2 D-isomerase (PTGDS) ELISA kit | CSB-EL018969RA
Cusabio Elisa

Guinea pig ovalbumin specific IgG, OVA sIgG ELISA Kit | CSB-E10139Gu
Cusabio Elisa

Bovine Growth/differentiation factor 8 (MSTN) ELISA kit | CSB-EL015057BO
Cusabio Elisa

Mouse D-Lactate Dehydrogenase, D-LDH ELISA Kit | CSB-E11723m
Cusabio Elisa

Mouse coagulation factor Ⅲ, FⅢ ELISA Kit | CSB-E17813m
Cusabio Elisa

Human Collagen Type Ⅲ, Col Ⅲ ELISA KIT | CSB-E04799h
Cusabio Elisa

Mouse CD81 antigen (CD81) ELISA kit | CSB-EL004960MO
Cusabio Elisa

Rat Agouti Related Protein, AGRP ELISA Kit | CSB-E13570r
Cusabio Elisa

Human Follistatin Like Protein 1 (FSTL1) ELISA Kit | CSB-E13516h
Cusabio Elisa

Human β-Thromboglobulin, β-TG ELISA Kit | CSB-E07886h
Cusabio Elisa

Human β-hexosaminidase A, β-Hex A ELISA Kit | CSB-E09462h
Cusabio Elisa

Rat tartrate-resistant acid phosphatase 5b, TRACP-5b ELISA Kit | CSB-E08491r
Cusabio Elisa

Human S100 calcium binding protein A9/calgranulin B, S100A9 ELISA Kit | CSB-E11834h
Cusabio Elisa

Rat Protein S100-A6 (S100A6) ELISA kit | CSB-EL020634RA
Cusabio Elisa

Rat Protein S100-A1 (S100A1) ELISA kit | CSB-EL020622RA
Cusabio Elisa

Mouse Interleukin 4, IL-4 ELISA KIT | CSB-E04634m
Cusabio Elisa

Mouse Interleukin 18, IL-18 ELISA Kit | CSB-E04609m
Cusabio Elisa

Pig Immunoglobulin A, IgA ELISA Kit | CSB-E13234p
Cusabio Elisa

Pig Interferon β, IFN-β/IFNB ELISA Kit | CSB-E09890p
Cusabio Elisa

Rat Interferon β, IFN-β/IFNB ELISA Kit | CSB-E04845r
Cusabio Elisa

Mouse Follistatin-related protein 1 (FSTL1) ELISA kit | CSB-EL009025MO
Cusabio Elisa

Rat Endostatin, ES ELISA Kit | CSB-E07975r
Cusabio Elisa

Rat dopamine, DA ELISA Kit | CSB-E08660r
Cusabio Elisa

Rat Collagen Type Ⅲ, Col Ⅲ ELISA KIT | CSB-E07924r
Cusabio Elisa

Rabbit Bone Alkaline Phosphatase (BALP) ELISA Kit | CSB-E15042Rb
Cusabio Elisa

Human Annexin Ⅲ (ANX-Ⅲ) ELISA Kit | CSB-E12157h
Cusabio Elisa

Human Rotavirus antigen, RV Ag ELISA Kit | CSB-E05033h
Cusabio Elisa

Human Agouti Related Protein, AGRP ELISA Kit | CSB-E09299h
Cusabio Elisa

Recombinant Human Growth/differentiation factor 6 (GDF6) | CSB-AP005971HU
Cusabio Active Proteins

Recombinant Rat Growth-regulated alpha protein (Cxcl1) (Active) | CSB-AP001391RA
Cusabio Active Proteins

Prev 200811 07
JopLink