Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) | CSB-EP757211GU

Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) | CSB-EP757211GU | Cusabio

Alternative Name(s): Interleukin-23 subunit alpha;IL-23 subunit alpha;IL-23-A;Interleukin-23 subunit p19;IL-23p19

Gene Names: IL23A

Research Areas: Cancer

Organism: Cavia porcellus (Guinea pig)

AA Sequence: RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 20-189aa

Sequence Info: Full Length of Mature Protein

MW: 26.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Reference: "Molecular cloning and functional characterization of guinea pig interleukin-23." Shiratori I., Seya T. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6LA37

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A