Cusabio Virus & Bacteria Recombinants
Recombinant Gloydius blomhoffii Disintegrin halysin | CSB-YP322037GGN
- SKU:
- CSB-YP322037GGN
- Availability:
- 25 - 35 Working Days
Description
Recombinant Gloydius blomhoffii Disintegrin halysin | CSB-YP322037GGN | Cusabio
Alternative Name(s): Platelet aggregation activation inhibitor
Gene Names: N/A
Research Areas: Others
Organism: Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
AA Sequence: EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-71aa
Sequence Info: Full Length
MW: 9.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Reference: "Halysin, an antiplatelet Arg-Gly-Asp-containing snake venom peptide, as fibrinogen receptor antagonist."Huang T.-F., Liu C.-S., Ouyang C.H., Teng C.-M.Biochem. Pharmacol. 42:1209-1219(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily
Tissue Specificity: Expressed by the venom gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P21858
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A