Recombinant Gloydius blomhoffii Disintegrin halysin | CSB-YP322037GGN

(No reviews yet) Write a Review
SKU:
CSB-YP322037GGN
Availability:
25 - 35 Working Days
  • Recombinant Gloydius blomhoffii Disintegrin halysin
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $2,427.60

Description

Recombinant Gloydius blomhoffii Disintegrin halysin | CSB-YP322037GGN | Cusabio

Alternative Name(s): Platelet aggregation activation inhibitor

Gene Names: N/A

Research Areas: Others

Organism: Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)

AA Sequence: EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-71aa

Sequence Info: Full Length

MW: 9.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.

Reference: "Halysin, an antiplatelet Arg-Gly-Asp-containing snake venom peptide, as fibrinogen receptor antagonist."Huang T.-F., Liu C.-S., Ouyang C.H., Teng C.-M.Biochem. Pharmacol. 42:1209-1219(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21858

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose