Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV

(No reviews yet) Write a Review
SKU:
CSB-EP360447ENV
Availability:
3 - 7 Working Days
  • Recombinant Escherichia coli Signal peptidase I (lepB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV | Cusabio

Alternative Name(s): Leader peptidase I

Gene Names: lepB

Research Areas: Microbiology

Organism: Escherichia coli (strain K12)

AA Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 78-324aa

Sequence Info: Partial

MW: 43.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.

Reference: "Sequence of the leader peptidase gene of Escherichia coli and the orientation of leader peptidase in the bacterial envelope."Wolfe P.B., Wickner W., Goodman J.M.J. Biol. Chem. 258:12073-12080(1983)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell inner membrane, Multi-pass membrane protein

Protein Families: Peptidase S26 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00803

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose